Protein Info for RS_RS17270 in Ralstonia solanacearum GMI1000

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 178 to 203 (26 residues), see Phobius details amino acids 215 to 240 (26 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 262 (251 residues), 135.8 bits, see alignment E=8.2e-44

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to rso:RS01987)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XTT9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>RS_RS17270 branched-chain amino acid ABC transporter permease (Ralstonia solanacearum GMI1000)
MEWFDNFWSVYSNLVLTLGINALLALSIYLTLSCGLLAMANAAFMGIGAYTSALLTMNAE
MPFPVALLGGMLAPAVVAVIIGRPTLRLSGVYLAMATLGFGEVVRVLILNTESWTGGALG
LNGIPQLTEWWHVALAVALTLFVLARLRRSKVGRAFEAIKEDETAAGLMGINVAGTKLLA
FVLGAMIAGLAGALNAHLTFFIGPAEFGFDRGVEILTMAILGGTNGLTGPVLGSVILSLL
PELLRAFKDFRLVVNGLILMLIVLFLPKGIWDPARFARWFGMKRGGTMPGASAASNESH