Protein Info for RS_RS17190 in Ralstonia solanacearum GMI1000

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 PF11638: DnaA_N" amino acids 13 to 75 (63 residues), 61.4 bits, see alignment E=1.3e-20 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 15 to 530 (516 residues), 560.9 bits, see alignment E=1.2e-172 PF00308: Bac_DnaA" amino acids 197 to 414 (218 residues), 289.3 bits, see alignment E=5.7e-90 PF00004: AAA" amino acids 233 to 354 (122 residues), 25.2 bits, see alignment E=5.1e-09 PF01695: IstB_IS21" amino acids 233 to 334 (102 residues), 25.3 bits, see alignment E=2.6e-09 PF08299: Bac_DnaA_C" amino acids 441 to 509 (69 residues), 108.1 bits, see alignment E=4.5e-35

Best Hits

Swiss-Prot: 100% identical to DNAA_RALSO: Chromosomal replication initiator protein DnaA (dnaA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to rso:RSc3442)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XTV4 at UniProt or InterPro

Protein Sequence (532 amino acids)

>RS_RS17190 chromosomal replication initiator protein DnaA (Ralstonia solanacearum GMI1000)
MAPGKHQTITMQDFWHAASAQLESELTPQQFKTWIKPLTPLSFDEQACMLRIAAPNRFKL
DWVKSQFSGRIQSLACDYWEMQVDVQFVLDPTAGQRQAAMQPALAPMPMQPLAAQTMQAQ
AVPREAPARPTMAPYRETPMATAAHAAADIDVPVMDAAEASTQSYRVPAPAAPAVMGGLS
APPAAPVDDTVHERSRLNPILTFDNLVTGKANQLARAAAVQVANNPGKSYNPLYLYGGVG
LGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHSLDLLLID
DIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVAIE
PPELEMRVAILMKKAQAENVTVPEEVAFFVAKHLRSNVRELEGALRKILAYSNFHGKEIT
IEVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMYLAK
ELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG