Protein Info for RS_RS17050 in Ralstonia solanacearum GMI1000

Annotation: CPBP family intramembrane metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 86 to 113 (28 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 167 to 197 (31 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details PF02517: Rce1-like" amino acids 135 to 219 (85 residues), 80.3 bits, see alignment E=5.4e-27

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 100% identity to rso:RSc3402)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XTZ3 at UniProt or InterPro

Protein Sequence (274 amino acids)

>RS_RS17050 CPBP family intramembrane metalloprotease (Ralstonia solanacearum GMI1000)
MPSSEHRYHFPNLLEAFFILIVLFFTEYLMNALIWKLGRNAGLQPMGIYSIGRVLAHGLV
FTVLLHHAKGTYRALVHENPSSWQATLAVFAGPVLLLTPGLLLLGSLLQMLVLQLFPMSS
SMSDGWHKFLTGGLGAIALICLIAPVVEEMLFRGIILRSFLRQYPAGVAIVHSAAVFGLA
HLNVYQFMLAFLLGLLLGKLYERTRSLLPGMLVHGCYNTAVTILAWRSERSEWTTVADWS
PQWCVLAMASGGAGAWLLYKLVAPRPADRAEPQA