Protein Info for RS_RS16580 in Ralstonia solanacearum GMI1000

Annotation: glutathione transferase GstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13409: GST_N_2
  • amino acids 10 to 75 (66 residues), 33.8 bits, E=1e-11
• PF00043: GST_C
  • amino acids 101 to 189 (89 residues), 43.3 bits, E=9.1e-15
• PF14497: GST_C_3
  • amino acids 105 to 194 (90 residues), 35.9 bits, E=1.8e-12
• PF13410: GST_C_2
  • amino acids 128 to 184 (57 residues), 33.1 bits, E=1.3e-11

Best Hits

Swiss-Prot: 45% identical to GST_PROMI: Glutathione S-transferase GST-6.0 (gstB) from Proteus mirabilis

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to rso:RSc3309)

MetaCyc: 42% identical to glutathione S-transferase GstA (Escherichia coli K-12 substr. MG1655)
Glutathione transferase. [EC: 2.5.1.18]

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See Q8XU84 at UniProt or InterPro

Protein Sequence (202 amino acids)

>RS_RS16580 glutathione transferase GstA (Ralstonia solanacearum GMI1000)
MKLYYAPGACSLAVHIALREVGVPFDLAAVDLAQHTTADGGDFYAVAPRGYVPVLELADG
SRHTEGAALLQHVADLDPSQALIGAPGSPRRLAVVQWLTFVSTELHKVFSPWLWHKETAE
STRQWVKDKLAARFAELEALFARQPWLTGDYSVADAYAFTVINWANLLALPLTPYPNLKA
YLERVAARPKVQEALRAEGLAK