Protein Info for RS_RS15790 in Ralstonia solanacearum GMI1000

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details PF17158: MASE4" amino acids 41 to 273 (233 residues), 142.7 bits, see alignment E=1.2e-45 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 283 to 448 (166 residues), 153 bits, see alignment E=3e-49 PF00990: GGDEF" amino acids 288 to 445 (158 residues), 147.5 bits, see alignment E=3.1e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc3143)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XUP3 at UniProt or InterPro

Protein Sequence (459 amino acids)

>RS_RS15790 GGDEF domain-containing protein (Ralstonia solanacearum GMI1000)
MDSFLIQQATQRQVVAAGTTALVIVLILATIAPQAAHPLPAVNPFMPMCALTVFTTAGIA
AFLLGAQFIVTRQPMLGALGGAYAFTALAVALQLLMFPGVFTPTGLFGAHPASAGWMWVF
WHGGFPFFVTLALLARERFKPEAVDATHIARWTWLLVGGPVAVGLLLCGLVLAVDLPPAL
GPADSSEVIGQATSRVLWALNVVALLLVLARGRLRSVLDLWLAIAALACFTDTSLNLLSP
SRFTLGWYVARIFSMFAPGVLVCVLVWEVTTLYRRLFEAHVSLQQLSTHDALTGIYNRSY
FNDQLPRAFDEARRRGRPFSLVMIDVDHFKRYNDTFGHLKGDGCLAAVASALEGVMPRHT
GFIARYGGEEFALVLPDAGPRDALLLAESAREAVLHLRLEAPAPSRYVTISAGCATAAPG
SAASLDALVAAADATLYRAKAAGRNLVVPAETAPPAQLA