Protein Info for RS_RS15410 in Ralstonia solanacearum GMI1000

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 154 to 173 (20 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 223 to 250 (28 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 320 (30 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details amino acids 465 to 491 (27 residues), see Phobius details amino acids 512 to 534 (23 residues), see Phobius details amino acids 540 to 559 (20 residues), see Phobius details PF21088: MS_channel_1st" amino acids 516 to 556 (41 residues), 36.8 bits, see alignment 3e-13 PF00924: MS_channel_2nd" amino acids 558 to 622 (65 residues), 55.6 bits, see alignment E=4.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc3068)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XUW5 at UniProt or InterPro

Protein Sequence (756 amino acids)

>RS_RS15410 mechanosensitive ion channel family protein (Ralstonia solanacearum GMI1000)
MRTFLLLLMQRLSPAVFLLLFCMSGGAGAAPASFAKLAGLPSATGSASSPVATPEQTRAS
LDAVITLLDSDQQRTALLGQLKQLRDGMAAQQTAQAQQAPGLLGAVASLIENGSLQADAE
AGAPRYWLHRVEAADDNLSLLAAPERRLRVLADFAGTVAVWAAIAGGLLGLGWGIRRVFG
LKAGLGPHPTTRALFVDALRKIGPWAASFAVLMRLEHEATPGFVLALVLAYAIVWGAIVT
AAVAMLFSLFAGSAHRRVAVELLLRRGMWPIFVAASLGACGDALVDPRVALVLGGALSLL
LATVCNAASSLMLAAGALWLRRPIGQLIANRSFEQRNGQHTGNQFRRAVAVLWPVPVVVL
AGATVLATLALPDNVDVVSRRAVMTSLLLAAAFLLSAVVRPRAHWHLHVRFGRTSPYLER
LKHFFSALVQLAIWVAFLELVTRVWGHTLAELLRSSVNGRRIADALVGLIGTVFSTWLAW
ILLDTAILQALSPAGGRARLQPSTRARTILPLLRNGLKVTLVVTAGIGVLANLGVNVTPL
VAGAGVIGLAVGFGAQSLAQDLITGIFILMEDTISVGDTVDVGVATGTVISLTIRTVRLR
DGVGAIHSIPFSQIKTVRNLSRDYSFADFEVRVAMDADPRQAIDLVREAAARTAGDVRFE
RILIGVPEVFGLDRFEGGAMIVKGRFKTRPQKQADVLRAFNVVLKEGFDAAGVPLAMPGT
VLRPSPALEQWMARAGALPGDADPAPVPQSPPAAPA