Protein Info for RS_RS15055 in Ralstonia solanacearum GMI1000
Annotation: 30S ribosomal protein S8
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS8_RALSO: 30S ribosomal protein S8 (rpsH) from Ralstonia solanacearum (strain GMI1000)
KEGG orthology group: K02994, small subunit ribosomal protein S8 (inferred from 96% identity to rsc:RCFBP_10445)MetaCyc: 64% identical to 30S ribosomal subunit protein S8 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S8p (S15Ae)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8XV26 at UniProt or InterPro
Protein Sequence (131 amino acids)
>RS_RS15055 30S ribosomal protein S8 (Ralstonia solanacearum GMI1000) MSMSDPIADMLTRIRNAQAVEKASVVMPSSKLKVAIAKVLKDEGYIDDFAVTEQGGKASL TIGLKYYAGRPVIERLERVSKPGLRVYKGRNEIPQVMNGLGVAIISTPQGLMTDRRARAT GVGGEVICYVA