Protein Info for RS_RS14775 in Ralstonia solanacearum GMI1000

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01914: MarC
  • amino acids 4 to 201 (198 residues), 207.6 bits, E=6.9e-66
• TIGR00427: membrane protein, MarC family
  • amino acids 5 to 198 (194 residues), 201.5 bits, E=6e-64

Best Hits

Swiss-Prot: 46% identical to YCHE_ECOLI: UPF0056 membrane protein YhcE (ychE) from Escherichia coli (strain K12)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to rso:RSc2949)

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

See Q8XV82 at UniProt or InterPro

Protein Sequence (207 amino acids)

>RS_RS14775 membrane protein (Ralstonia solanacearum GMI1000)
MDLTKSFFSLLALINPIGAIPFFISLTESQTDEEKRRTIKTASVSVALVIGISALLGEQI
IGFFGFSVGSLQVGGGIIMIMIALNMLNAQTSRTKATPEEEDEAGVRASIAVVPLAIPLL
TGPGSISTVIVYAGKTQHWYELLFLAGVGVLIALVVWIVLRAAEPIARVIGRTGINVGTR
LMGLILAALAVEFIVDGLKTLLPVLKS