Protein Info for RS_RS14495 in Ralstonia solanacearum GMI1000

Annotation: ubiquinone biosynthesis hydroxylase UbiH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 16 to 430 (415 residues), 428.1 bits, see alignment E=1.4e-132 PF01494: FAD_binding_3" amino acids 16 to 380 (365 residues), 97.2 bits, see alignment E=1.2e-31 PF08491: SE" amino acids 323 to 397 (75 residues), 22.8 bits, see alignment E=4.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc2893)

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVD8 at UniProt or InterPro

Protein Sequence (430 amino acids)

>RS_RS14495 ubiquinone biosynthesis hydroxylase UbiH (Ralstonia solanacearum GMI1000)
MNTPAFSSSAGAPAFHVAVVGGGIVGRACALRLAQAGLRVAHVAPAASPAPSSAPAGPDA
WDARVYAFSSSSQALLEQLRIWPALDMSRVQPVQDMRVFGDAAAARGEHAHADLHFSAYA
AGAPQLAWIAESSLVERALETALRFSHTVQTFAHAATGFEMEADAVRLTLSDGQAIRAEC
VVGADGKQSWVRQQAGIRADAKPYRQLGVVANFQAEHWHQDTAWQWFLGASVDGARASGD
TAPARGEILAMLPLPDRRVSMVWSAGEDHARDLLALSPDALCRAVEAAAGGAVAARFGRL
SCVTPALGFPLVLQQAERLVAPRVALVGDAAHVIHPLAGQGMNLGLRDVAELGQVMAERE
TMRDHGDLRLLRRYERARREDLLSLTAATDGLHTLFALPGALPRMVRNAGMRVVGLTPFI
KRLLVRHALG