Protein Info for RS_RS14425 in Ralstonia solanacearum GMI1000

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00702: Hydrolase" amino acids 10 to 192 (183 residues), 111.1 bits, see alignment E=2.3e-35 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 13 to 224 (212 residues), 207.8 bits, see alignment E=2.1e-65 PF13419: HAD_2" amino acids 13 to 198 (186 residues), 110.8 bits, see alignment E=2.2e-35 PF12710: HAD" amino acids 13 to 189 (177 residues), 39.5 bits, see alignment E=2.1e-13 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 86 to 197 (112 residues), 47.7 bits, see alignment E=2.8e-16 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 115 to 192 (78 residues), 28.7 bits, see alignment E=2.4e-10 PF13242: Hydrolase_like" amino acids 153 to 220 (68 residues), 44.8 bits, see alignment E=2.4e-15

Best Hits

Swiss-Prot: 46% identical to GPH_THIDA: Phosphoglycolate phosphatase (Tbd_2229) from Thiobacillus denitrificans (strain ATCC 25259)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to rso:RSc2880)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVF1 at UniProt or InterPro

Protein Sequence (246 amino acids)

>RS_RS14425 phosphoglycolate phosphatase (Ralstonia solanacearum GMI1000)
MTDALPAGPVRVVIIDLDGTMVDTAGDFHAAINAMLETLGAAPDMPAQEIVGYVGKGSEN
LVRRVLDARLPPAQANSRFAEALDAYQRAYLAINGRYARVYDGVREGLDALRGMGLALAC
VTNKPHDFTQPLLAQLGLAPCFDLVYPGDAFPYRKPDPYPMLRVAEAFGVSPADIVAIGD
SENDARAARAAGMRVLAVPYGYNHGQPVQAAGADAIVDSLFAAAQLIRPHATSGHTMHRA
MSAASN