Protein Info for RS_RS14390 in Ralstonia solanacearum GMI1000

Annotation: 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02280: phenylacetate degradation probable enoyl-CoA hydratase PaaB
  • amino acids 6 to 262 (257 residues), 470.9 bits, E=5.1e-146
• PF00378: ECH_1
  • amino acids 13 to 261 (249 residues), 216.9 bits, E=2.9e-68
• PF16113: ECH_2
  • amino acids 15 to 180 (166 residues), 97.8 bits, E=9.1e-32

Best Hits

Swiss-Prot: 58% identical to PAAG_ECOLI: 1,2-epoxyphenylacetyl-CoA isomerase (paaG) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to rso:RSc2873)

MetaCyc: 59% identical to 1,2-epoxyphenylacetyl-CoA isomerase (Pseudomonas sp. Y2)
RXN0-6510 [EC: 5.3.3.18]

Predicted SEED Role

"Phenylacetate degradation enoyl-CoA hydratase PaaA (EC 4.2.1.17)" (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• adipate degradation (5/5 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• phenylacetate degradation I (aerobic) (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• superpathway of phenylethylamine degradation (8/11 steps found)
• valproate β-oxidation (6/9 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• 3-phenylpropanoate degradation (6/10 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 5.3.3.18

Sequence Analysis Tools

See Q8XVF8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>RS_RS14390 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (Ralstonia solanacearum GMI1000)
MTSPTILLDWHDRVATITLNRPDQLNSFTAGMHRELREALDKVERQRARALILTGAGRGF
CAGQDLSELNVTPGQMTDLGTLIDQQFNPLVRRLRALPLPVIAAVNGVAAGAGANLALAC
DIVLAAENACFLQAFVKIGLLPDSGGTWFMPQRIGVARAMGLAMLGEKLDARTALAWGLI
WGVYHDAKILMTEVQAMADHLSKQPTRALAAIKRAMHAAPTQSLDAQLDLERDLQRELGH
SRDYAEGVDAFLHKRVAHFTGE