Protein Info for RS_RS14160 in Ralstonia solanacearum GMI1000

Annotation: NUDIX domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF00293: NUDIX" amino acids 27 to 118 (92 residues), 64.8 bits, see alignment E=8.2e-22 PF14815: NUDIX_4" amino acids 28 to 125 (98 residues), 64.3 bits, see alignment E=9e-22

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to rso:RSc2831)

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVJ9 at UniProt or InterPro

Protein Sequence (153 amino acids)

>RS_RS14160 NUDIX domain-containing protein (Ralstonia solanacearum GMI1000)
MGGSMSADTITQASATHTPDGRKITEVAVGVLVQPDGRFLLAQRPEGKPYAGYWEFPGGK
LESGESVEAALTRELKEELDITLRACERWHTIEHDYPHAYVRLHFCKVTAWDGALRALEG
QDFAWQTLPISVDPVLPATLPVFEWMRVEAGAS