Protein Info for RS_RS14060 in Ralstonia solanacearum GMI1000

Annotation: hypoxanthine-guanine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details PF00156: Pribosyltran" amino acids 15 to 163 (149 residues), 64.3 bits, see alignment E=4.2e-22

Best Hits

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 98% identity to rsl:RPSI07_0695)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVL8 at UniProt or InterPro

Protein Sequence (182 amino acids)

>RS_RS14060 hypoxanthine-guanine phosphoribosyltransferase (Ralstonia solanacearum GMI1000)
MLSAEQARELWANSEEIVSEAAVHASLDRMAAEITEKIGDTFPMVLSVMGGACVFTGMLL
PKLAFPLEFDYIHLSRYNNKTVGGEMQWRVAPRESVKDRTVLVLDDILDEGETMAAIRSR
IIDMGAAEFYSAVLCEKTLAKDKPLHPDFCGFPVPDRYVFGCGMDAKGYWRNLPAIRALR
NS