Protein Info for RS_RS13855 in Ralstonia solanacearum GMI1000

Annotation: phosphatidylglycerophosphatase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 44 to 70 (27 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details PF04608: PgpA" amino acids 45 to 188 (144 residues), 109.2 bits, see alignment E=8.3e-36

Best Hits

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 96% identity to rsc:RCFBP_10691)

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVR0 at UniProt or InterPro

Protein Sequence (192 amino acids)

>RS_RS13855 phosphatidylglycerophosphatase A (Ralstonia solanacearum GMI1000)
MMSSAPFPPSTPPSQPETVVLEAGQTAQVRRPTARFMFGHPARILALGFGSGLSPVMPGT
MGTLYAWLVYAVLSRWIAGPGWLLIAAIGFVIGIGACARTARDLGVADHGAMVWDEMVAF
WLVLAFVTPTTLGGQFAAFLWFRFFDMVKPAPIRYYDRTLKGFGLRGGYGVMVDDILAAF
YTLLVFALWRSF