Protein Info for RS_RS13840 in Ralstonia solanacearum GMI1000

Annotation: ribonuclease N1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF00545: Ribonuclease" amino acids 57 to 140 (84 residues), 110.5 bits, see alignment E=2.5e-36

Best Hits

Swiss-Prot: 49% identical to RNS3_KITAU: Guanyl-specific ribonuclease Sa3 (rnaSA3) from Kitasatospora aureofaciens

KEGG orthology group: K01167, ribonuclease T1 [EC: 3.1.27.3] (inferred from 100% identity to rso:RSc2766)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of rna"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.27.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVR3 at UniProt or InterPro

Protein Sequence (143 amino acids)

>RS_RS13840 ribonuclease N1 (Ralstonia solanacearum GMI1000)
MTKRLGAWIGRSVSQAMVRGALAAMLALSVAGLPTAAAARDTTGMSAAVGTIPAVDLPNE
AQRTLVQIEQGGPFPYAKDGTTFGNYEGRLPARKRGYYREYTVKTRGARNRGARRIICGG
DQRAANDCYYTEDHYNSFQRIQR