Protein Info for RS_RS13795 in Ralstonia solanacearum GMI1000

Annotation: arabinose import ATP-binding protein AraG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF00005: ABC_tran" amino acids 20 to 169 (150 residues), 109.1 bits, see alignment E=2.8e-35 amino acids 271 to 429 (159 residues), 69.6 bits, see alignment E=4.5e-23

Best Hits

Swiss-Prot: 100% identical to ARAG_RALSO: Arabinose import ATP-binding protein AraG (araG) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K10539, L-arabinose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to rso:RSc2757)

Predicted SEED Role

"L-arabinose transport ATP-binding protein AraG (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVS2 at UniProt or InterPro

Protein Sequence (511 amino acids)

>RS_RS13795 arabinose import ATP-binding protein AraG (Ralstonia solanacearum GMI1000)
MSAFLEFRGISKVFPGVRALSEVSFGIECGRVHGLLGENGAGKSTLLKILGGDYQPDGGQ
IAVEGRPVAFPNARAALAAGIAVIHQELQTVPELTVMDNLLLGHLPSRGGFIRQGEAMAW
TRAQLARIGVDLDPKARLKHLSIGQRQMVEICKAILRDARVIALDEPTSSLSVRETDILF
RLVKDLRAQGRALIYISHRLDEIFALCDGCTIFRDGRKVADFRSMADVTREQLVAQMVGR
QIDDIFGYRPRAPGDVRLRVEGLMGPKLAEPASFAVRRGEIVGLFGLVGAGRSELARLVY
GADRKTAGTVVLDGEPIRIRAVADAIRQGIVLCPEDRKEEGIIGCRSVSENINISCRRNR
RPGWGGFNLFVDDRQEAKTADHYIARLRIKTPHRDQPIRLLSGGNQQKAILARWLAEDGM
RVLIIDEPTRGIDVGAKNEIYQVLYELAERGVAVLMISSELPEILGVADRVLVMSEGRIA
GELPRAQATEHAVLNLALRPRRDPCVAAQAA