Protein Info for RS_RS13415 in Ralstonia solanacearum GMI1000

Annotation: prepilin-type N-terminal cleavage/methylation domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details PF07963: N_methyl" amino acids 14 to 37 (24 residues), 26.7 bits, see alignment 2.9e-10 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 15 to 38 (24 residues), 26.8 bits, see alignment 1.6e-10 PF12019: GspH" amino acids 56 to 150 (95 residues), 48.2 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc2679)

Predicted SEED Role

"Type IV fimbrial biogenesis protein FimT" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XVZ6 at UniProt or InterPro

Protein Sequence (162 amino acids)

>RS_RS13415 prepilin-type N-terminal cleavage/methylation domain-containing protein (Ralstonia solanacearum GMI1000)
MHRTFMPPRSGKPSCRGVTLPELLVGLAVLSILIVIAVPSFSGLIATQRARNASLDLSAA
ITLARSEAVKQNTTATVSSTGNWATGWALAVNSTVIRTFGPYTGVTIAPSNGNTLSIGND
GRPTAGAVTFLVTPTTSAQTSSTICVQVGGTGRVALVTGGCS