Protein Info for RS_RS13145 in Ralstonia solanacearum GMI1000

Annotation: phosphoribosylformylglycinamidine cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase" amino acids 15 to 342 (328 residues), 454.6 bits, see alignment E=1.1e-140 PF00586: AIRS" amino acids 67 to 172 (106 residues), 88 bits, see alignment E=6e-29 PF02769: AIRS_C" amino acids 186 to 347 (162 residues), 131.4 bits, see alignment E=3.4e-42

Best Hits

Swiss-Prot: 100% identical to PUR5_RALSO: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 100% identity to rso:RSc2623)

MetaCyc: 61% identical to phosphoribosylformylglycinamide cyclo-ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylformylglycinamidine cyclo-ligase. [EC: 6.3.3.1]

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XW52 at UniProt or InterPro

Protein Sequence (353 amino acids)

>RS_RS13145 phosphoribosylformylglycinamidine cyclo-ligase (Ralstonia solanacearum GMI1000)
MSASETPSASASRGLSYRDAGVDIEAGDALVDRIKPFAKRTLREGVLGGIGGFGALFEIS
KKYQEPVLVSGTDGVGTKLKLAFALNRHDTVGQDLVAMSVNDILVQGAEPLFFLDYFACG
KLDVDTAATVIKGIAQGCELAGCALIGGETAEMPSMYPAGEYDLAGFAVGAVEKRKIIDG
TTIACGDVVLGLASSGAHSNGYSLVRKIIEVSRPDLNADFHGQRLQDAIMAPTRIYVKPL
LALIDKLPVKGMAHITGGGLVENVPRVLPEGVTAVLHQDAWTLPPLFQWLQKAGNVADDE
MHRVFNCGIGMIVIVSAADAPAAIAHLKDAGETVYQIGEIRARQPGEAQTIVI