Protein Info for RS_RS12910 in Ralstonia solanacearum GMI1000

Annotation: conjugative transfer protein TrbI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details PF03743: TrbI" amino acids 231 to 411 (181 residues), 212.9 bits, see alignment E=1.9e-67

Best Hits

KEGG orthology group: K03195, type IV secretion system protein VirB10 (inferred from 100% identity to rso:RSc2575)

Predicted SEED Role

"Conjugative transfer protein TrbI" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XWA0 at UniProt or InterPro

Protein Sequence (425 amino acids)

>RS_RS12910 conjugative transfer protein TrbI (Ralstonia solanacearum GMI1000)
MSQDDTPDLAAPQAGKVAPEAVALRAQPRPVTRLNRRTLAILAGTLSVAVLGALMWSLQP
QRRGAGEQTELYNVERVSKSEGLDALPADYSKLPPPLPASVPELGPPLPGDLGPAIVKSH
QPMTAAYAAPGHDPNDALRKEAEAAAASSVFFRLGSQAAPVAQTQVAAAPDFAANAAFDR
LAAGPASTAAQPADPTAVQNLQDQKEAFQKAGNTETRNSGNLTLPASPYQVMAGTVVAGA
LVTGIKSDLPGDVIATVTEPVYDTATGRFLLIPQGSRILGKYNSQVSYGQSRVQVVWNRI
ILPDTSSLTLDNLAGTDPAGYAGLEDDVDYHWGRIFAGAALTTLLGVGAELAAPENRQDG
NRIVIAGRDSAQDSINQVGQEMTRRNMNIQPTLTERPGLPVRIIVNRDLVLRPYQPLFFN
RGTSR