Protein Info for RS_RS12685 in Ralstonia solanacearum GMI1000

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 23 to 335 (313 residues), 356.5 bits, E=6.8e-111
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 29 to 319 (291 residues), 216.2 bits, E=3.1e-68

Best Hits

Swiss-Prot: 100% identical to LPXK_RALSO: Tetraacyldisaccharide 4'-kinase (lpxK) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to rso:RSc2530)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (12/17 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (12/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See Q8XWE4 at UniProt or InterPro

Protein Sequence (349 amino acids)

>RS_RS12685 tetraacyldisaccharide 4'-kinase (Ralstonia solanacearum GMI1000)
MPVAQHRLASFVTRQWQRRGWFARMLWPLSLLFGAVSGLRRRLFRWGWLRSVRLPVPVVV
VGNVTVGGAGKTPAVIALASALADAGLRPGIVSRGYGAQLKHPRPVREHSRAEDVGDEPL
LIARATDLPVWVYPDRVLCAQTLLASHPGCNVIVCDDGLQHYRLRRDIEIVVFDLRMGGN
GFLLPAGPLREPMTRRRDATLINDPNYRATHDRPDIYGMRLDLQDAYNLADPALRRPLSQ
FARLSGDQLLAAAGIGNPERFFASLRAAGLQPATLPLPDHYDFADNPFADAGAETILITE
KDAVKCGHLDDPRIWVVPTTPVVDAALVEQVCRRVRALADRSTSQAGAQ