Protein Info for RS_RS12655 in Ralstonia solanacearum GMI1000

Annotation: site-2 protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 154 to 182 (29 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details PF02163: Peptidase_M50" amino acids 40 to 112 (73 residues), 36.2 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc2524)

Predicted SEED Role

"Membrane metalloprotease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XWF0 at UniProt or InterPro

Protein Sequence (241 amino acids)

>RS_RS12655 site-2 protease family protein (Ralstonia solanacearum GMI1000)
MAKLLILLLSGLKFGKLLTTGGTMLLSVMAYAFVFGWRYAAGFVVLLFIHEMGHYVAARQ
RGLAVGAPTFIPFVGAWIDLKEQPMDVETEAYIGLAGPVAGTVGAMLCYGLARWTDSQLL
LALAYAGCFLNLFNLIPLAPFDGGRITAVLSPRIWFLGVPVLVALFVWRMSPILVLMAIL
AVPQLMKAWRYDPDAPENRAYYSISAEARLTFTVYYLGLVVFLAMMTHELHGMLETIRPA
G