Protein Info for RS_RS12625 in Ralstonia solanacearum GMI1000

Annotation: GntP family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 99 to 127 (29 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 442 to 463 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc2518)

Predicted SEED Role

"D-beta-hydroxybutyrate permease" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XWF6 at UniProt or InterPro

Protein Sequence (466 amino acids)

>RS_RS12625 GntP family permease (Ralstonia solanacearum GMI1000)
MSVVVVLAALAFLMFAAYRGYSVILFAPLAALGAVLLTDPSAVAPVFAGIFMEKLVGFVK
LYFPVFLLGAVFGKVIELSGFSRAIVASVIRVVGAQRAMLSIVLVCALLTYGGVSLFVVV
FAVYPFAAEMFRQGNIPKRLIPGTIALGAFSFTMDSLPGTPQIQNIIPTTFFHTTSWAAP
WLGTAGAIFILAVGMAYLEWRRRAAVRACHGYDAGLARLVNEPDTVAGGKLAHPLVALLP
LVLVGVMNLLFTRWIPEWYGKLVTVALPGLPKPLTVEADKLTAIWAVEAALLIGIVVVVV
SGLRAVKDRFAEGSKSAVAGALLAAMNTASEYGFGGVIAALPGFLVLAGGLRAIPDPLVN
EAVTVSTLAGITGSASGGMSIALAAMADAFVQAAQATGIPMEVLHRVASMASGGMDTLPH
NGAVITLLAVTGLTHREAYRDIFCVTLIKTAAVFFVIAMFYATGIV