Protein Info for RS_RS12305 in Ralstonia solanacearum GMI1000

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 224 to 250 (27 residues), see Phobius details amino acids 253 to 277 (25 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 265 to 329 (65 residues), 57.2 bits, see alignment E=1.4e-19 PF21082: MS_channel_3rd" amino acids 337 to 420 (84 residues), 39.1 bits, see alignment E=8.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc2451)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XWM3 at UniProt or InterPro

Protein Sequence (447 amino acids)

>RS_RS12305 mechanosensitive ion channel family protein (Ralstonia solanacearum GMI1000)
MNGLPLNHIALGRMIGDIVDDLGGPRFIWQLGVLALLLGVAWLAARPIARRLHARHAGDS
FALRFAWASLERAVFPLLGWLLVLAARYALTGVMPISVFRLAVVPLFGLAMLYFVFYVLR
RVLSANGDLHGMLVLVERVLTTLMWIGMVLYVVGVLSDVVSYLEGIQFSVGGKQKVNLAA
MLMAVVWILLTVLVAMWFGSWLDSRITRAAAIDANLKVVLSRVAKAALLLVSLLLSLSLV
GIDLTVLSVFGGALGVGLGFGLQKIASNYVSGFIILLERSLKLGDQITVSTYTGIVTQIR
TRYTVVRNGDGDTFVPNELMVAQAVQNHNERGTVRVAVRVQAAYPADPEVVLGLLVACAE
GVPRVLADPAPAAFLAAFADSGIEYELGVWIADPHNGKLGVQSDLNRAIYKRFKAAGVEI
PYPQREVRLLGPLAVQQSSLSDSGAAS