Protein Info for RS_RS12245 in Ralstonia solanacearum GMI1000

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 284 to 310 (27 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 42 to 349 (308 residues), 172.1 bits, see alignment E=6.9e-55

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to rso:RSc2439)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XWN4 at UniProt or InterPro

Protein Sequence (378 amino acids)

>RS_RS12245 ABC transporter ATP-binding protein (Ralstonia solanacearum GMI1000)
MTETATEFKAPKKTRAALLGFFVLAIFAPFLVGAVGGNYWVRVLDFALLYIMLALGLNIV
VGFAGLLDLGYIAFYAVGAYMMALLGSPHLTNQFEWIHQLFPNGLHLLIWWVIPLGAGLA
ALFGILLGAPTLKLRGDYLAIVTLGFGEIIRIFMNNLDRPVNITNGPKGVNLIEPVKLFG
FDFSKRHDIFGIHFEPVHMYYYLFVLLAMGIITVCLRLQNSRIGRAWVAIREDEIAAKAM
GINTRNIKLLAFAMGASFGGVSGAMFASFQGFVSPESFVLWESIYILAIVVLGGMGHIPG
VILGGILLVGFQELLRALAEPIQNKLFGHVIVEAEVLRQLLFGLAMVGVMLYRPAGLWPS
PRKEDRPQKARVGGLSRI