Protein Info for RS_RS12100 in Ralstonia solanacearum GMI1000

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00126: HTH_1" amino acids 3 to 61 (59 residues), 85.2 bits, see alignment E=2.4e-28 PF03466: LysR_substrate" amino acids 87 to 301 (215 residues), 133 bits, see alignment E=1e-42

Best Hits

Swiss-Prot: 54% identical to ILVR_CAUVC: HTH-type transcriptional regulator IlvR (ilvR) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 100% identity to rso:RSc2411)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XWR2 at UniProt or InterPro

Protein Sequence (311 amino acids)

>RS_RS12100 LysR family transcriptional regulator (Ralstonia solanacearum GMI1000)
MDLRQLRYFVTVAEELHFGRAAARLAMTQPPLSQQIRALEEELGVALFHRTQRSVALTPV
GARWLVEVRRVLAEAGALPALAQRLARGEVGSLSLAFVSTADYGILPAMLRHFRDARPDV
QVQLREATSDVQIEALLADEIDAGVVIAHHIGSVPGELEYRPLAREGLVLAVPAARAAQW
GARPGRPIALADVAAEPLIIFPRRSAPALYDIITGYHAAHGGAQEASARIAQEAIQMQTI
VSLVSAEMGVALVPASLCNLQRTGVVYLELAEPSPVIETGLVWRRDAVSPVVPWFVASAE
AVARLHDNPQP