Protein Info for RS_RS11980 in Ralstonia solanacearum GMI1000

Annotation: segregation/condensation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF02616: SMC_ScpA" amino acids 73 to 288 (216 residues), 121.6 bits, see alignment E=2.7e-39

Best Hits

KEGG orthology group: K05896, segregation and condensation protein A (inferred from 100% identity to rso:RSc2386)

Predicted SEED Role

"Segregation and condensation protein A" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XWT4 at UniProt or InterPro

Protein Sequence (293 amino acids)

>RS_RS11980 segregation/condensation protein A (Ralstonia solanacearum GMI1000)
MTTPAQDKLPLSVELPSVAPEQDSTPAQIDGLAFARLYGEPLFKLPQDLYIPPDALEIFL
EAFEGPLDLLLYLIRRQNFNVLDIPMAQVTRQYLAYIEQIRATNLELAAEYLLMAAMLIE
IKSRMLLPVKKTDSGEEPEDPRAELVRRLLEYEQMKLAAQKLDTVPVLGRDFLRAQVYIE
QSLAPRYPDVNADDLRAAWADVLRRAKLTQHHKISREELSVREHMSQILRRLQHARFMEF
TELFDDVIRSGKGAPIVVVNFVAMLELSRESLLEITQAEPYAPIYVRLAYSPT