Protein Info for RS_RS11625 in Ralstonia solanacearum GMI1000

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF12802: MarR_2" amino acids 8 to 55 (48 residues), 35.1 bits, see alignment E=4.7e-12 PF13412: HTH_24" amino acids 8 to 55 (48 residues), 61.2 bits, see alignment E=2.2e-20 PF13404: HTH_AsnC-type" amino acids 8 to 49 (42 residues), 59.2 bits, see alignment E=1.1e-19 PF01047: MarR" amino acids 12 to 55 (44 residues), 33.7 bits, see alignment E=1.1e-11 PF09339: HTH_IclR" amino acids 14 to 55 (42 residues), 23.4 bits, see alignment E=1.6e-08 PF01037: AsnC_trans_reg" amino acids 74 to 139 (66 residues), 54.6 bits, see alignment E=3.4e-18

Best Hits

Swiss-Prot: 39% identical to YEZC_BACSU: Uncharacterized HTH-type transcriptional regulator YezC (yezC) from Bacillus subtilis (strain 168)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to rso:RSc2318)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XX00 at UniProt or InterPro

Protein Sequence (151 amino acids)

>RS_RS11625 Lrp/AsnC family transcriptional regulator (Ralstonia solanacearum GMI1000)
MKPKAVELDRLDWRILEVLQTHARVTNTELGKQIGLSQPAVSARIRRLEEQGVIEGYSAR
INPELAGRDISALIRIQTTHAQITKCLKAFATMPEIIEAHRITGDDCFIVRAVVQRMKQL
ETVVDALARFGPVTTSIVLASYPPKAIGEIR