Protein Info for RS_RS11310 in Ralstonia solanacearum GMI1000

Annotation: CoA transferase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02428: 3-oxoacid CoA-transferase, B subunit
  • amino acids 12 to 217 (206 residues), 310.9 bits, E=1.6e-97
• PF01144: CoA_trans
  • amino acids 15 to 204 (190 residues), 152.9 bits, E=4.4e-49

Best Hits

Swiss-Prot: 70% identical to PCAJ_PSEPU: 3-oxoadipate CoA-transferase subunit B (pcaJ) from Pseudomonas putida

KEGG orthology group: K01032, 3-oxoadipate CoA-transferase, beta subunit [EC: 2.8.3.6] (inferred from 100% identity to rso:RSc2253)

MetaCyc: 82% identical to adipate CoA-transferase beta subunit (Cupriavidus necator H16)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"3-oxoadipate CoA-transferase subunit B (EC 2.8.3.6)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.8.3.6)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• adipate degradation (5/5 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• 3-oxoadipate degradation (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• TCA cycle III (animals) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• aromatic compounds degradation via β-ketoadipate (6/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of salicylate degradation (4/7 steps found)
• pyruvate fermentation to acetate VI (1/3 steps found)
• catechol degradation III (ortho-cleavage pathway) (3/6 steps found)
• reductive TCA cycle I (6/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• reductive TCA cycle II (6/12 steps found)
• methylaspartate cycle (11/19 steps found)
• mandelate degradation to acetyl-CoA (7/18 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.6, 6.2.1.5

Use Curated BLAST to search for 2.8.3.6 or 6.2.1.5

Sequence Analysis Tools

See Q8XX63 at UniProt or InterPro

Protein Sequence (220 amino acids)

>RS_RS11310 CoA transferase subunit B (Ralstonia solanacearum GMI1000)
MNAEATAKIQRWTRDQIAARVARDIPDGSVVNLGIGLPTLVANQLPADREILLHSENGLL
GMGPAPAPGAEDPDLINAGKQPVTIKPGGAYFHHADSFAMMRGGHLDYCVLGAFQVSAAG
DLANWHTGAPDAIPAVGGAMDLAIGAKQVFVMMEHQTKQGDSKIVPACTYPLTGIGCVDT
IYTDLAVIDVTPGGLIVREMADGLDFETLQTLTAVPLRRA