Protein Info for RS_RS11305 in Ralstonia solanacearum GMI1000

Annotation: 3-oxoadipyl-CoA thiolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02430: 3-oxoadipyl-CoA thiolase
  • amino acids 3 to 400 (398 residues), 738.8 bits, E=1.6e-226
• PF00108: Thiolase_N
  • amino acids 5 to 268 (264 residues), 247.7 bits, E=2e-77
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 6 to 398 (393 residues), 452.2 bits, E=1.4e-139
• PF00109: ketoacyl-synt
  • amino acids 89 to 137 (49 residues), 21.3 bits, 2.7e-08
• PF02803: Thiolase_C
  • amino acids 276 to 399 (124 residues), 155.5 bits, E=7.4e-50

Best Hits

Swiss-Prot: 73% identical to PCAF_PSEAE: Beta-ketoadipyl-CoA thiolase (pcaF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00632, acetyl-CoA acyltransferase [EC: 2.3.1.16] (inferred from 100% identity to rso:RSc2252)

MetaCyc: 86% identical to 3-oxoadipyl-CoA thiolase (Cupriavidus necator H16)
3-oxoadipyl-CoA thiolase. [EC: 2.3.1.174]

Predicted SEED Role

"Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" in subsystem Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.3.1.-)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• fatty acid salvage (6/6 steps found)
• adipate degradation (5/5 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• ketolysis (3/3 steps found)
• polyhydroxybutanoate biosynthesis (3/3 steps found)
• 3-oxoadipate degradation (2/2 steps found)
• phenylacetate degradation I (aerobic) (7/9 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• adipate biosynthesis (4/5 steps found)
• ketogenesis (4/5 steps found)
• superpathway of phenylethylamine degradation (8/11 steps found)
• L-isoleucine degradation I (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• acetoacetate degradation (to acetyl CoA) (1/2 steps found)
• aromatic compounds degradation via β-ketoadipate (6/9 steps found)
• valproate β-oxidation (6/9 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of salicylate degradation (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• 3-phenylpropanoate degradation (6/10 steps found)
• 5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
• catechol degradation III (ortho-cleavage pathway) (3/6 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• glycerol degradation to butanol (10/16 steps found)
• isopropanol biosynthesis (engineered) (2/5 steps found)
• pyruvate fermentation to acetone (2/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (3/7 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• ethylbenzene degradation (anaerobic) (1/5 steps found)
• fatty acid β-oxidation VII (yeast peroxisome) (1/5 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• acetyl-CoA fermentation to butanoate (2/7 steps found)
• 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (4/10 steps found)
• methyl tert-butyl ether degradation (4/10 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
• 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
• 4-ethylphenol degradation (anaerobic) (1/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• L-tryptophan degradation III (eukaryotic) (7/15 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (1/7 steps found)
• mevalonate pathway II (haloarchaea) (1/7 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• isoprene biosynthesis II (engineered) (1/8 steps found)
• mevalonate pathway III (Thermoplasma) (1/8 steps found)
• mevalonate pathway IV (archaea) (1/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)
• mandelate degradation to acetyl-CoA (7/18 steps found)
• L-lysine fermentation to acetate and butanoate (1/10 steps found)
• 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
• 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• jasmonic acid biosynthesis (5/19 steps found)
• toluene degradation VI (anaerobic) (4/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (3/17 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
• sitosterol degradation to androstenedione (1/18 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
• superpathway of testosterone and androsterone degradation (7/28 steps found)
• superpathway of ergosterol biosynthesis I (5/26 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (9/42 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)
• superpathway of L-lysine degradation (9/43 steps found)
• superpathway of cholesterol biosynthesis (5/38 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.16

Use Curated BLAST to search for 2.3.1.- or 2.3.1.16 or 2.3.1.174

Sequence Analysis Tools

See Q8XX64 at UniProt or InterPro

Protein Sequence (400 amino acids)

>RS_RS11305 3-oxoadipyl-CoA thiolase (Ralstonia solanacearum GMI1000)
MTEAFICDAIRTPIGRYGGSLSAVRADDLGAVPLKALMARNPRVDWSAIDDVIFGCANQA
GEDNRNVARMSALLAGLPDSVPGSTINRLCGSGMDATGTAARAIRAGETALMIAGGVESM
SRAPFVMGKAASAFSRDAAMYDTTIGWRFVNPLMQAQYGVDSMPETAENVAADYRVSRED
QDRFALRSQASAARAQADGTLAQEITPVTIAQKKGDPIVVDRDEHPRATTLEALARLKGV
VRPAGTVTAGNASGVNDGACALLLANEEAAKRFGLTPRARIIGMATAGVPPRVMGIGPAP
ASQKVLGQLGLTIDQMDVIELNEAFAAQGLAVTRQLGLADDDARVNPNGGAIALGHPLGM
SGARLVTTAMYQLQRTGGRYALCTMCIGVGQGIALVIERV