Protein Info for RS_RS11290 in Ralstonia solanacearum GMI1000

Annotation: 4-carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02425: 4-carboxymuconolactone decarboxylase
  • amino acids 4 to 124 (121 residues), 196.5 bits, E=6.5e-63
• PF02627: CMD
  • amino acids 36 to 118 (83 residues), 94.4 bits, E=1.6e-31

Best Hits

Swiss-Prot: 51% identical to DC4C_ACIAD: 4-carboxymuconolactone decarboxylase (pcaC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 100% identity to rso:RSc2249)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (6/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

See Q8XX67 at UniProt or InterPro

Protein Sequence (131 amino acids)

>RS_RS11290 4-carboxymuconolactone decarboxylase (Ralstonia solanacearum GMI1000)
MDERDRHHAGMQVRRAVLGDAHVDRATAAQTELTAPFQDLITRYAWGEIWTRPGLPRHTR
SLLTIAMMVALNRDGELRLHLRAAANNGVTREEIQEVLLQTAIYCGVPAANHAFHLAQAV
FADMDAEAAAK