Protein Info for RS_RS11170 in Ralstonia solanacearum GMI1000

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details PF00892: EamA" amino acids 21 to 120 (100 residues), 31.7 bits, see alignment E=7.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc2225)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XX91 at UniProt or InterPro

Protein Sequence (324 amino acids)

>RS_RS11170 EamA/RhaT family transporter (Ralstonia solanacearum GMI1000)
MSTDHTMPIAQQTISSSRQSLWMVLAAFAFSAMGVCVKLASAHYSTGEIVFYRSLIGVAL
MGAVLYHTGAGVRTPHFASHIKRSVFGVTSLLLWFSSISLLPLATAMTLNYMSPVWIALI
IGAGATLAGKAGGADRKMVTAILMSFVGVICLLQPSVGPSQMTGGMIGLVSGVFTALAYV
EVRQLGDLGENEARIVFYFSLVSSIAGGAWMLIAGAHAHTWQSAWLLVAVGLLATLGQTA
MTRAYKRGNTLLTANLQYTGIVFASGWGMLLWHDHLNALSWMGMALIIGSGIVTTVMRAR
QSGVAHPTPQTAVSGPEAEIHPEV