Protein Info for RS_RS10995 in Ralstonia solanacearum GMI1000

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02844: GARS_N
  • amino acids 1 to 100 (100 residues), 130.2 bits, E=9.2e-42
• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 420 (420 residues), 565.4 bits, E=3.8e-174
• PF01071: GARS_A
  • amino acids 101 to 294 (194 residues), 262.7 bits, E=4.3e-82
• PF02786: CPSase_L_D2
  • amino acids 103 to 212 (110 residues), 24.1 bits, E=4.9e-09
• PF02843: GARS_C
  • amino acids 329 to 418 (90 residues), 110.6 bits, E=7.6e-36

Best Hits

Swiss-Prot: 100% identical to PUR2_RALSO: Phosphoribosylamine--glycine ligase (purD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 100% identity to rso:RSc2191)

MetaCyc: 62% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

See Q8XXC4 at UniProt or InterPro

Protein Sequence (422 amino acids)

>RS_RS10995 phosphoribosylamine--glycine ligase (Ralstonia solanacearum GMI1000)
MKVMVVGSGGREHALAWKLARSPKVQVVYVAPGNGGTALDKRLQNVPITDPEVLAAFAER
EGVHFTVVGPEAPLAAGIVDLFRAKGLRIFGPTRAAAQLESSKDFAKAFMQRHGIPTAKY
QTFGNAAEAHAYVDREGAPIVIKADGLAAGKGVVVAMTLEEAHGAIDMMLADNRLGDAGA
RVVIEEFLAGEEASFIVVCDGKDVVAMATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPT
LHARVLREIILPTIRGMEKDGIPYTGFLYAGLMIDADGTPKTLEFNCRMGDPETQPIMAR
MKTDLFDVLDRAIDGKLDGMELDWDRRTALGVVMAAYNYPDTPRKGDVITGIPKETEDSV
TFHAGTTLKDGALTTSGGRVLCVVGLADTVKAAQRAAYGAVEQIQFDGAQYRKDIGHRAI
RR