Protein Info for RS_RS10340 in Ralstonia solanacearum GMI1000

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 11 to 152 (142 residues), 257.9 bits, see alignment E=1.2e-81 PF01058: Oxidored_q6" amino acids 37 to 146 (110 residues), 98.7 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 100% identical to NUOB_RALSO: NADH-quinone oxidoreductase subunit B (nuoB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 95% identity to bmn:BMA10247_0414)

MetaCyc: 62% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XXQ2 at UniProt or InterPro

Protein Sequence (160 amino acids)

>RS_RS10340 NADH-quinone oxidoreductase subunit B (Ralstonia solanacearum GMI1000)
MAIEGVLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFR
PSPRQSDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCD
RIVPVDVYVPGCPPTAEALIYGIIQLQAKIRRTNTIARKG