Protein Info for RS_RS10200 in Ralstonia solanacearum GMI1000

Annotation: urease subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00192: urease, beta subunit
  • amino acids 1 to 100 (100 residues), 148.5 bits, E=2.9e-48
• PF00699: Urease_beta
  • amino acids 3 to 100 (98 residues), 151.8 bits, E=2.2e-49

Best Hits

Swiss-Prot: 100% identical to URE2_RALSO: Urease subunit beta (ureB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01429, urease subunit beta [EC: 3.5.1.5] (inferred from 100% identity to rso:RSc2033)

MetaCyc: 63% identical to urease beta subunit (Sinorhizobium meliloti Rm2011)
Urease. [EC: 3.5.1.5]

Predicted SEED Role

"Urease beta subunit (EC 3.5.1.5)" in subsystem Urea decomposition (EC 3.5.1.5)

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Purine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Sequence Analysis Tools

See Q8XXT0 at UniProt or InterPro

Protein Sequence (101 amino acids)

>RS_RS10200 urease subunit beta (Ralstonia solanacearum GMI1000)
MIPGELLPQDGDLELNAGRPTLTVTVANTGDRPVQIGSHYHFHEVNDALRFDREATRGYR
LNIAAGTAVRFEPGQERTVELVALAGDRVVYGFAGRVMGKL