Protein Info for RS_RS09940 in Ralstonia solanacearum GMI1000

Annotation: SPOR domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 69 to 87 (19 residues), see Phobius details PF05036: SPOR" amino acids 197 to 268 (72 residues), 43.6 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc1978)

Predicted SEED Role

"DedD protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XXY5 at UniProt or InterPro

Protein Sequence (273 amino acids)

>RS_RS09940 SPOR domain-containing protein (Ralstonia solanacearum GMI1000)
MGLFSIFSSRKPAESARGAAGSAADVARDAVRESRAASASRSRAARRDDDVDDGLDPELP
QKQRARRRLIGAVVLVGAAVVVLPLVFDAKPRPVTDGVAVQIQDQPVDRGAKASADEPKV
ASRRSAPRADGAAPQQAQALDQGEEVVSSAGGTSAASTPAAAKPSPKAAAGATATDTKPQ
AKPAASVQAAPAAEAKDGKFLLLIGAFASEDRARNWLSKLKGEKIPGYIEHKKVPEKGDL
ALLRAGPFNDRASAEMAQKRAEQLGLTPKLVQQ