Protein Info for RS_RS09700 in Ralstonia solanacearum GMI1000

Annotation: phage baseplate assembly protein V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR01644: phage baseplate assembly protein V" amino acids 6 to 203 (198 residues), 225.6 bits, see alignment E=1.9e-71 PF04717: Phage_base_V" amino acids 16 to 81 (66 residues), 51.4 bits, see alignment E=1.1e-17 PF18946: Apex" amino acids 183 to 204 (22 residues), 35.2 bits, see alignment (E = 1e-12)

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc1925)

Predicted SEED Role

"Baseplate assembly protein V"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XY38 at UniProt or InterPro

Protein Sequence (205 amino acids)

>RS_RS09700 phage baseplate assembly protein V (Ralstonia solanacearum GMI1000)
MDTADLARLLQNLLRLGTITDVRHSTPPAVRVRTGGITTTWRPWAERRAGRTRTWNPPTV
GEQVLLFCPSGDPANAVILCGIPTADNDVPSNDPNRTVTLYPDGALTSYDHAAGLLTVQG
VKTVFLEAAANVLVKAPNTTFDGDVTVKGRFAYENGIAGHGGENGNKITGSLTHEGGQLS
SNGVVLDKHDHGGVQRGGDWTEGTR