Protein Info for RS_RS09380 in Ralstonia solanacearum GMI1000

Annotation: ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01433: ubiquinol oxidase, subunit II
  • amino acids 35 to 257 (223 residues), 402 bits, E=3.2e-125
• PF00116: COX2
  • amino acids 170 to 238 (69 residues), 28.8 bits, E=1e-10
• PF06481: COX_ARM
  • amino acids 257 to 299 (43 residues), 55.9 bits, 3.2e-19

Best Hits

Swiss-Prot: 54% identical to CYOA_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 2 (cyoA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to rso:RSc1858)

MetaCyc: 52% identical to cytochrome bo3 subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• proline to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See Q8XYA4 at UniProt or InterPro

Protein Sequence (330 amino acids)

>RS_RS09380 ubiquinol oxidase subunit II (Ralstonia solanacearum GMI1000)
MLKPTALPADNPPQGRLAAPPSPIPSRLVALALGALASLLLSGCNLELLSPKGSIGEQEK
SLILVALFVMLLVVIPVIVLTLWFAWRYRETNTRAAYAPTWAHSTTIEIVVWGIPCLIVA
FLGVLIWNTTHKLDPYRPLASQVEPVEIEVIALNWKWLFIYPQYGVASLNQLAIPVGTPI
NFRLTAESMMNAFFIPQLGSMVYTMAGMQTRLHLIADTPGVYLGQSAAYSGAGFSDMHFK
TLATSREAFDAWVRSAKASANTLDFKTYRGLERPSNRDAVTLFSAVAPKLFDRVVDKYML
ANGQVCRADGPESLQAFQPIPSASIGRVEQ