Protein Info for RS_RS09070 in Ralstonia solanacearum GMI1000

Annotation: pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR03181: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit" amino acids 11 to 349 (339 residues), 479.9 bits, see alignment E=1.8e-148 PF00676: E1_dh" amino acids 39 to 319 (281 residues), 262.4 bits, see alignment E=4.4e-82 PF13292: DXP_synthase_N" amino acids 134 to 197 (64 residues), 37.2 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 100% identity to rso:RSc1797)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1, 1.2.4.4

Use Curated BLAST to search for 1.2.4.1 or 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XYG1 at UniProt or InterPro

Protein Sequence (363 amino acids)

>RS_RS09070 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha (Ralstonia solanacearum GMI1000)
MSTVGSFQIDYTQYLDPEGQPVQPLPAFAQDVPTLLALYRAMVLTRAFDTKAIALQRTGK
LGTFASSVGQEAIGVGVASAMRAEDVLFPSYRDHSAQLLRGVSMAESLLYWGGDERGSCF
AAVREDFPNCVPIGTQVCHAAGAAYAFQLRREPRVAVAVFGDGGTSKGDFYEGMNLAGVW
GAPLVLIVNNNQWAISVPRSRQTAAQTLAQKAIAAGIAGRQVDGNDVIAVRQAAQDALDK
ARSGGGPTLIEALSYRLGDHTTADDATRYRDPDSVKQAWAREPILRLRNYLMRLSAWDKA
QEEQLGRACYAQVEEAVAAYLAVGQPGPSAMFDHLYAALPRALEAQRAMALAFAPQGGEG
GHG