Protein Info for RS_RS08060 in Ralstonia solanacearum GMI1000

Annotation: dihydrolipoyllysine-residue acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 6 to 75 (70 residues), 75.1 bits, E=7.9e-25
  • amino acids 124 to 195 (72 residues), 78.2 bits, E=8.7e-26
• TIGR01348: dihydrolipoyllysine-residue acetyltransferase
  • amino acids 105 to 554 (450 residues), 639.8 bits, E=2.2e-196
• PF01597: GCV_H
  • amino acids 121 to 184 (64 residues), 22.4 bits, E=2.5e-08
• PF02817: E3_binding
  • amino acids 249 to 283 (35 residues), 56.2 bits, 8.1e-19
• PF00198: 2-oxoacid_dh
  • amino acids 330 to 553 (224 residues), 274.7 bits, E=1.5e-85

Best Hits

Swiss-Prot: 75% identical to ODP2_CUPNH: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to rso:RSc1601)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (2/4 steps found)
• pyruvate fermentation to acetate II (1/3 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.12

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

See Q8XZ05 at UniProt or InterPro

Protein Sequence (554 amino acids)

>RS_RS08060 dihydrolipoyllysine-residue acetyltransferase (Ralstonia solanacearum GMI1000)
MSQVVEIKVPDIGDYKDVPVIELHVKAGDTVSAEDSLVTLESDKATMDVPSPKSGVVKEV
KIKVGDAVSEGSLVLLLEEQGATAASAPQAAPAPAPVAAALAPAAQAPVSAPAAQPAAGG
GTIEVKVPDIGDYKDVPVIEISVKVGDKVEAEQSLITLESDKATMDVPSPAAGTVKDIRV
KVGDAVSEGTLIVVLEGAGGAAAAAPAPAPAPAAAAPSPAPAVAPVAAPAAAPATYTADT
VGTIGKAAHASPSVRKYARELGVDVNLVGGTGPKNRITQEDVQRYVKGVMTGQAAAPGKA
AAAAAPAGGGELNLLPWPKVDFTKFGPVEPKPLSRIKKISGANLHRNWVMIPHVTNNDEA
DITELEAFRVQMNKEHEKAGVKFTMLAFVIKAVVGALKKFPTFNASLDGDNLVFKQYYHI
GFAADTPNGLVVPVIRDADKKGVVDIAREMAELSKAAREGKLKPDQMQGGCFSISSLGGI
GGTHFTPIINAPEVAILGLSRGYQKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNA
YLAAVLADFRRVLL