Protein Info for RS_RS07950 in Ralstonia solanacearum GMI1000
Annotation: 50S ribosomal protein L35
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL35_RALSO: 50S ribosomal protein L35 (rpmI) from Ralstonia solanacearum (strain GMI1000)
KEGG orthology group: K02916, large subunit ribosomal protein L35 (inferred from 97% identity to rsl:RPSI07_1667)Predicted SEED Role
"LSU ribosomal protein L35p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8XZ27 at UniProt or InterPro
Protein Sequence (65 amino acids)
>RS_RS07950 50S ribosomal protein L35 (Ralstonia solanacearum GMI1000) MPKMKTKKSASKRFTARPGGTIKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLKSVRA MMPYA