Protein Info for RS_RS06590 in Ralstonia solanacearum GMI1000

Annotation: peptidoglycan endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00877: NLPC_P60" amino acids 71 to 178 (108 residues), 105.2 bits, see alignment E=8.8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc1314)

Predicted SEED Role

"Cell wall-associated hydrolases (invasion-associated proteins)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8XZT1 at UniProt or InterPro

Protein Sequence (258 amino acids)

>RS_RS06590 peptidoglycan endopeptidase (Ralstonia solanacearum GMI1000)
MPNRHGSPRSSTRWAGLAIIALACLLSACSSTPTRSLTSRDTSGQRTHGAAINDPSAGLE
EISIEAMALVGTPYRYGGNTPDSGFDCSGLVRYVVQRAASVNLPRTAAEMGTRGFALERR
DVASGDLVFFNTTGRPNSHVGIYVGQNRFVHAPATGGTVRLEDMSKRYWASRYMGARRVV
AVSNLPDLPASPAAATQSIAAGAAAPATAPAHANDDDPLGTLARARGTESSPLMSTRNAA
PVVVPPADDDPIARFATQ