Protein Info for RS_RS06220 in Ralstonia solanacearum GMI1000

Annotation: rhizopine-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 25 to 285 (261 residues), 188.1 bits, see alignment E=2.3e-59 PF00532: Peripla_BP_1" amino acids 40 to 246 (207 residues), 57.4 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 58% identical to MOCB_RHIML: Putative rhizopine-binding protein (mocB) from Rhizobium meliloti

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 100% identity to rso:RSc1241)

Predicted SEED Role

"Inositol transport system sugar-binding protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y004 at UniProt or InterPro

Protein Sequence (309 amino acids)

>RS_RS06220 rhizopine-binding protein (Ralstonia solanacearum GMI1000)
MKNTLMAAAAAAAILATPLAHAEKIGVAMALFDDTGLTILRNGIADTAKKHGATVQIEDA
GNDVGKQLSQVQNMIAQKVDAIIVNPVDTDATPKITRMVTEAKIPLVYVNRKPVDFDKLP
AGVAVVASDERLSGTLQARQVCKLLGGKGDLLVLMGELSNESARARTKDIEDVIATNACA
GMKIVDKREGRWSRTLGQDITMNWLSTGMKFDAIVSNNDEMAIGAINALKSARKWTPKTI
VAGIDATPDGLASMRSGDLKVSVFQNLPGQGAAAIDAAIKLAKKQPVERFVNVPFELVTP
ENLTQYAKH