Protein Info for RS_RS06175 in Ralstonia solanacearum GMI1000
Annotation: ribose-5-phosphate isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RPIA_RALSO: Ribose-5-phosphate isomerase A (rpiA) from Ralstonia solanacearum (strain GMI1000)
KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 100% identity to rso:RSc1232)MetaCyc: 62% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]
Predicted SEED Role
"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)
MetaCyc Pathways
- superpathway of glucose and xylose degradation (15/17 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- pentose phosphate pathway (7/8 steps found)
- Bifidobacterium shunt (12/15 steps found)
- Rubisco shunt (8/10 steps found)
- pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- Calvin-Benson-Bassham cycle (9/13 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
- oxygenic photosynthesis (10/17 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Pentose phosphate pathway
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.3.1.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8Y013 at UniProt or InterPro
Protein Sequence (228 amino acids)
>RS_RS06175 ribose-5-phosphate isomerase (Ralstonia solanacearum GMI1000) MTQDELKALVAQAAADYVLANVPEGAVLGVGTGSTANLFIDAMAPHKARFAGAVSSSEAS TRRLQGHGFAVLDLNEVDTIPVYVDGADEIDDTGAMIKGGGGALTREKIVASVAGRFVCI ADGSKLVDVLGAFPLPVEVVPMARAAVARQLAALGGQPRLRMTKEGQIYQTDNGNVILDV SGLRIGEPKTLEAQINDIPGVVTVGLFAKRGADVLLLGTEAGVQRRDF