Protein Info for RS_RS05270 in Ralstonia solanacearum GMI1000

Annotation: GTPase Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00231: small GTP-binding protein domain" amino acids 25 to 188 (164 residues), 90.1 bits, see alignment E=1.4e-29 TIGR00436: GTP-binding protein Era" amino acids 25 to 297 (273 residues), 271.4 bits, see alignment E=8e-85 PF02421: FeoB_N" amino acids 27 to 183 (157 residues), 50.6 bits, see alignment E=5e-17 PF01926: MMR_HSR1" amino acids 27 to 140 (114 residues), 93.8 bits, see alignment E=2.2e-30 PF00009: GTP_EFTU" amino acids 27 to 192 (166 residues), 34.8 bits, see alignment E=4e-12 PF04548: AIG1" amino acids 28 to 128 (101 residues), 39.2 bits, see alignment E=1.5e-13 PF07650: KH_2" amino acids 227 to 302 (76 residues), 64.6 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 100% identical to ERA_RALSO: GTPase Era (era) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 98% identity to rsl:RPSI07_2328)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y0I0 at UniProt or InterPro

Protein Sequence (315 amino acids)

>RS_RS05270 GTPase Era (Ralstonia solanacearum GMI1000)
MTDTPLQPPQPPQSLPGVPEGFRCGMVAIVGRPNVGKSTLMNALVGQKVSITSRKAQTTR
HRITGIQTTDDAQFVFVDTPGFQTRHATALNRSLNRAVTSTLTSVDAVLFVVEAGRYGPD
DAKVLSLLPRETPVILIVNKVDRLDAYTRAEMVAVFLQEMAQVFPFKEIVPMSAKNRDDI
LRLLGIVRPYLPEGEPMYDPEALTDRSERFLAAEIVREKVFRWTGDELPYSSTVVVDKFE
TEGRLRRVFVTILVDRDAHKAMIIGAKGAKLKQISTEARMDMEKLFDGKVYLEVWVKVKS
GWADNEAGLRAYGYE