Protein Info for RS_RS05265 in Ralstonia solanacearum GMI1000

Annotation: ribonuclease 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR02191: ribonuclease III" amino acids 6 to 219 (214 residues), 236.8 bits, see alignment E=1e-74 PF14622: Ribonucleas_3_3" amino acids 17 to 139 (123 residues), 128.6 bits, see alignment E=2.5e-41 PF00636: Ribonuclease_3" amino acids 35 to 125 (91 residues), 76.8 bits, see alignment E=3.1e-25 PF00035: dsrm" amino acids 153 to 218 (66 residues), 50.7 bits, see alignment E=3.2e-17

Best Hits

Swiss-Prot: 100% identical to RNC_RALSO: Ribonuclease 3 (rnc) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to rso:RSc1063)

MetaCyc: 53% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y0I1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>RS_RS05265 ribonuclease 3 (Ralstonia solanacearum GMI1000)
MSLEALQQRLGYRFSKPELLQQALTHRSHNAMHNERLEFLGDSILNCAVADMLYGMFGKL
DEGDLSRVRANLVKQQALYEIAQMLLLPDELRLGEGELKSGGFRRPSILADALEAIFGAV
FLDGGFDAARTLIRKLYIPILEQVDPRTLGKDAKTLLQEYLQGHKIALPQYAVVATHGAA
HNQQFEVECTIPKLEIRVSGSGASRRAAEQSAAKLALEEAHRLVPQLVKRSRAERTGKTR
KQATPPDPQLSLRLKE