Protein Info for RS_RS05235 in Ralstonia solanacearum GMI1000

Annotation: sugar dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF03888: MucB_RseB" amino acids 49 to 222 (174 residues), 180.3 bits, see alignment E=2.7e-57 PF17188: MucB_RseB_C" amino acids 245 to 348 (104 residues), 89.1 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: K03598, sigma-E factor negative regulatory protein RseB (inferred from 100% identity to rso:RSc1057)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseB precursor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y0I7 at UniProt or InterPro

Protein Sequence (365 amino acids)

>RS_RS05235 sugar dehydratase (Ralstonia solanacearum GMI1000)
MSKVWHPVAGAGARKLQAVRRSVFLLLCVSALSVAAQSQQPEPMPRKEAASWLTKIHRAA
LKQNYVGTLTYQRGSGMHSTRIQHYTDLFNNEYERVEALDGKQREMLRQNDVVRNLIYEV
KLVVTEKQENKDSFPALLATTNGDVLDQYDMRHLPAERVAGMDCEVFQLDPKDGFRYAYR
IWAERSSGLLIRAQTIGEDGKVLEQVAFSQVEVGVPSEKQKILAALKSVTGWNQYEVVSQ
PTNLAEQGWAITSPIKGFQKIREVRRPLGDIAPAGKSSSGFEVQQVVFSDGLAGLSLFIE
PVSEKRSRREGFISQGATHVMVRRIADFWLTVVGEVPFATIKQFGAAVDYKPVSANAASR
PASTP