Protein Info for RS_RS05200 in Ralstonia solanacearum GMI1000

Annotation: 3-oxoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 4 to 326 (323 residues), 422 bits, see alignment E=7.4e-131 PF00108: Thiolase_N" amino acids 53 to 152 (100 residues), 31.3 bits, see alignment E=2.2e-11 PF08545: ACP_syn_III" amino acids 114 to 191 (78 residues), 115.6 bits, see alignment E=1.1e-37 PF08541: ACP_syn_III_C" amino acids 238 to 325 (88 residues), 125.3 bits, see alignment E=1.3e-40

Best Hits

Swiss-Prot: 100% identical to FABH_RALSO: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to rso:RSc1050)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y0J4 at UniProt or InterPro

Protein Sequence (326 amino acids)

>RS_RS05200 3-oxoacyl-ACP synthase III (Ralstonia solanacearum GMI1000)
MTRYARIIGTGSYLPPKRVTNHELAAQLAEQGIETSDEWIVTRSGIRARHYAEPDVTCSD
LAAKAAERAIEAAGIDRAEIDLILVATSTPDFVFPSAACLVQQKLGLSNHCAAFDLQAVC
SGFVYGLATADKFIRAGGYRNALVIGAEVFSRILDFNDRTTCVLFGDGAGAVVLQASDEP
GILSTALHADGSHADILCVPGNVAGGAIKGSAFLYMDGQAVFKLAVNVLDKVAREALALA
EVESSQIDWLIPHQANIRIMQGTAKKLGLPGERMVVTVDEHGNTSAASIPLALDAAVRDG
RIQKGHHVLLEGVGGGFTWGAALLRF