Protein Info for RS_RS04710 in Ralstonia solanacearum GMI1000

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00303: Thymidylat_synt" amino acids 3 to 264 (262 residues), 431.3 bits, see alignment E=5.8e-134 TIGR03284: thymidylate synthase" amino acids 3 to 84 (82 residues), 135.8 bits, see alignment E=8.8e-44 amino acids 85 to 264 (180 residues), 322.4 bits, see alignment E=1.2e-100

Best Hits

Swiss-Prot: 100% identical to TYSY_RALSO: Thymidylate synthase (thyA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 100% identity to rso:RSc0947)

MetaCyc: 71% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y0U6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>RS_RS04710 thymidylate synthase (Ralstonia solanacearum GMI1000)
MQPYLDLMRHVHEHGTDKADRTGTGTRSVFGHQMRFDLQQGFPLVTTKKVHIKSIVYELL
WFLQGATNVRWLRENGVTIWDEWADAEGELGPIYGYQWRSWPTPSGEHIDQIAELIAQIK
RNPDSRRLIVSAWNVADIPRMKLPPCHAFFQFYVADGKLSCQLYQRSADIFLGVPFNIAS
YALLTHMIAQQTGLDVGDFVWTGGDCHLYNNHFEQVETQLARTPLPLPKLHIKRKPDSIF
DYRYEDFEIVGYESHPAIKAPVAV