Protein Info for RS_RS04680 in Ralstonia solanacearum GMI1000

Annotation: peptidase M48

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 99 to 126 (28 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details PF16491: Peptidase_M48_N" amino acids 26 to 204 (179 residues), 201.3 bits, see alignment E=1.2e-63 PF01435: Peptidase_M48" amino acids 207 to 415 (209 residues), 116.7 bits, see alignment E=1.2e-37

Best Hits

KEGG orthology group: K06013, STE24 endopeptidase [EC: 3.4.24.84] (inferred from 100% identity to rso:RSc0941)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y0V2 at UniProt or InterPro

Protein Sequence (418 amino acids)

>RS_RS04680 peptidase M48 (Ralstonia solanacearum GMI1000)
MPTFTAVFLIALVLMAATRLWLAARQIRHVARHRDTVPAQFAESITLDMHHKAADYTIAR
TRLAMLEVPVQATLLIALTLLGGLNGLNQAWLSAFGPGYAYGVALIASVIAISSLIELPF
SLYSQFVVEERFGFNRMTWKLWLADNLKGLAIGTALGLPLLLAVLWLMHSMGERWWLYTW
LVWMAFTLFVQAIYPNVIAPLYNKFTPLEDGEMRTRIEGLLKRCGFASKGLFVMDGSRRS
AHGNAYFSGFGATKRIVFFDTLLARLDAPEMEAVLAHELGHFKRHHVTKRIAVMFVLSLG
LLALLGWLMTRAWFYLGLGVAPNLLADNHALALMLFFLVLPVFMFFVSPLSSLSSRKHEF
EADAFAAQHADASRLVSALVKLFQDNASTLTPDPVYSAFYYSHPTASQRVARLVQAAA