Protein Info for RS_RS04390 in Ralstonia solanacearum GMI1000

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 transmembrane" amino acids 69 to 90 (22 residues), see Phobius details PF19622: DUF6127" amino acids 17 to 78 (62 residues), 89.9 bits, see alignment E=4.5e-30

Best Hits

KEGG orthology group: None (inferred from 99% identity to rsl:RPSI07_0265)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y112 at UniProt or InterPro

Protein Sequence (96 amino acids)

>RS_RS04390 membrane protein (Ralstonia solanacearum GMI1000)
MNAPMVADGMVTMPRAEFEELLERVAESGARAALAEVGLDGENAANDIRELRGLLDAFNE
AKRTAWQTMVRMITTGLVLALVAGAVIKFELFKGAR